Protein Info for Atu0992 in Agrobacterium fabrum C58

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details amino acids 261 to 280 (20 residues), see Phobius details PF00892: EamA" amino acids 9 to 141 (133 residues), 50.4 bits, see alignment E=1.5e-17 amino acids 151 to 277 (127 residues), 47.6 bits, see alignment E=1.1e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0992)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJM0 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Atu0992 permease (Agrobacterium fabrum C58)
MSLAHERSSGIYLVAASAVLWSTAGLFVRMADMDMWSMVAWRSAFTFLALGAFFLLRNRF
ARQRSSMSFGFPGIAGCLVSAIAAITYIASLRWTTVANVMTIYATLPFIVAGIAFVCLRD
RVTYRFVIAGCLAFVGVLISVGAAVSHQDMLGIFAAFIMTTGCATQIVIAKRFPDMDTTL
MTALAALICICVALPLMQFEIPAPTQIIACALYGVLTTAFGYIFLLQGSRRINAGEAGLI
SMLDVILGPVWVWLFYNEVISPIVLTGGGIVIMSVAWYLAGDRRAATAP