Protein Info for Atu0990 in Agrobacterium fabrum C58

Annotation: NAD/NADP dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00106: adh_short" amino acids 8 to 196 (189 residues), 128.2 bits, see alignment E=5.7e-41 PF23441: SDR" amino acids 10 to 258 (249 residues), 31 bits, see alignment E=3.5e-11 PF13561: adh_short_C2" amino acids 14 to 258 (245 residues), 147.8 bits, see alignment E=7.9e-47 PF08659: KR" amino acids 17 to 129 (113 residues), 29.7 bits, see alignment E=1.2e-10

Best Hits

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 100% identity to atu:Atu0990)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100, 1.1.1.30

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D071 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Atu0990 NAD/NADP dependent oxidoreductase (Agrobacterium fabrum C58)
MDFGISGKRALVLASSRGLGLGIATALAKEGANVLLVGRSGEKLAENCKAINALGKGKAD
WVWGDLADDNFVESMVQAVEDKLGGIDILVNNTGGPTPGLAQEMTVDKLDTFFQSMVLRV
ITLTNALLPQMKEQGFGRILTVASSGVFEPIPNLALSNTLRGALVGWSKTLSSEVASFGI
TSNLLLPGRIHTDRIDELDGANAKRLGKSIEEVREASVKGIPAGRLGTVEEFAAAGAFLC
SVPASYITGTMLRVDGGAAKSN