Protein Info for Atu0987 in Agrobacterium fabrum C58

Annotation: DNA polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 TIGR00758: uracil-DNA glycosylase, family 4" amino acids 124 to 288 (165 residues), 150 bits, see alignment E=2.8e-48 PF03167: UDG" amino acids 137 to 286 (150 residues), 103 bits, see alignment E=7.6e-34

Best Hits

KEGG orthology group: K02334, DNA polymerase bacteriophage-type [EC: 2.7.7.7] (inferred from 100% identity to atu:Atu0987)

Predicted SEED Role

"Uracil-DNA glycosylase, family 4"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJM2 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Atu0987 DNA polymerase (Agrobacterium fabrum C58)
MIAAHDLSPAELAALLHFHADAGVDWMLEEAPVDRFAEFAAARPMPGQDAATPARQAQSP
ADRRTDAPQRQAPGRSAPARGAPAAPAIQQNVAMPDEQAVSAARFAAESARSLGELRTAL
EGFNGCNLKNSARNTIFSEGDPASAIMVIGPMPDADDDREGTPFAGKTGQLLERMLAAIG
LERSAIMIGNVVPWRPPGNRPPTQAEMDICRPFIERQIALAEPKHLLLLGNFTARFFFGG
TGTIHTLRGQWRDVAAGHLILPALASLHPQELLNAPASKSLAWQDLLAFQTKITEG