Protein Info for Atu0979 in Agrobacterium fabrum C58

Annotation: two component sensor kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details PF00672: HAMP" amino acids 184 to 235 (52 residues), 43.9 bits, see alignment 5e-15 PF00512: HisKA" amino acids 242 to 305 (64 residues), 40.6 bits, see alignment E=4.4e-14 PF02518: HATPase_c" amino acids 351 to 451 (101 residues), 72.4 bits, see alignment E=8e-24 PF13581: HATPase_c_2" amino acids 356 to 437 (82 residues), 28 bits, see alignment E=3.8e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0979)

Predicted SEED Role

"Sensor protein basS/pmrB (EC 2.7.3.-)" in subsystem Lipid A modifications or Orphan regulatory proteins (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJM6 at UniProt or InterPro

Protein Sequence (469 amino acids)

>Atu0979 two component sensor kinase (Agrobacterium fabrum C58)
MARLRILFRSTAVRLSALYILLFALCAAFLVFYVTALSERLLNQQTRDAVLQEVSDVQRI
YNRGGINPLLRMMERRARQPGASLYIIAGPNGEILAGNVASVQPGVFDKEGWTGFPFRYE
RYSESGDSVQHLATANVFMLDNGLRILIGRDLGEPTKFRALVRNALMVALAIMSGGALLI
WFGIGRNALKRIDRMSAATKRIIAGDLSQRLPQGRSGDEFDRLSGSLNAMLGRIEKLNEG
LRQVSDNIAHDLKTPLTRLRNKAAAALDDNDETKRRAALEGIIAESDQLIRTFNALLMIS
RVEAGSIAAEMTDVDMSAIAADSAELYEPVAEDAGLALESQIEPGLSVQGNRELIGQALS
NLIDNAMKYACEGEGDKKLVVRLVKEPEAIVLSVADHGPGIPADKRGEVLKRFVRLDESR
SKPGTGLGLSLVEAVMELHGGSLVLSDTDATNTACPGLTISMVFPISKP