Protein Info for Atu0942 in Agrobacterium fabrum C58

Annotation: MFS permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 82 to 106 (25 residues), see Phobius details amino acids 112 to 129 (18 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 204 to 222 (19 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 301 to 323 (23 residues), see Phobius details amino acids 335 to 354 (20 residues), see Phobius details amino acids 360 to 382 (23 residues), see Phobius details amino acids 394 to 416 (23 residues), see Phobius details amino acids 435 to 455 (21 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 319 (296 residues), 76.9 bits, see alignment E=1.5e-25 PF00083: Sugar_tr" amino acids 53 to 125 (73 residues), 26.2 bits, see alignment E=3.7e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0942)

Predicted SEED Role

"Multidrug resistance protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D0B0 at UniProt or InterPro

Protein Sequence (460 amino acids)

>Atu0942 MFS permease (Agrobacterium fabrum C58)
MVEKNGWGELLSGANLSLLTVISSGIGLHAFNQFAVVTALPVAVNDIGGAGFYSWAYSLY
FVGSVAGGVTAVLFRERFGARAILLLCCLIFSFGSVLSAIAGDFLWVVVGRALQGVADGL
IVAVCYSLIPAGFRSGLLPKVFAIEAAIWAVASFIGPLTGGFATQHISWRATFLLSAPLI
IVLVVYTVVAVSAERPVVATRRPLVPLLLCLVGALAFSAPSAFEDASLRAISLLAGAALL
WASLRAGIQPSSGLFPRDSFRLKTVLGSGFWVLFLMSYAHALGSVYLAYVAINLWQHEPT
FAGFIVVTMPLAWSFVAMLIGSLRSNRLREICLHYGPYQMVPGCVLLGLGLATGNWGEML
LGQTLIGSAFGMSWAGISQAAMEAAPEEERKMTGALLPTVATLGSAAGAGASGTVAAATD
LVVQIDRADVTTPMLYLYGLGVVVSLLAIMTARGLRGERR