Protein Info for Atu0932 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF03692: CxxCxxCC" amino acids 24 to 92 (69 residues), 48.4 bits, see alignment E=6.5e-17

Best Hits

Swiss-Prot: 100% identical to Y932_AGRFC: UPF0260 protein Atu0932 (Atu0932) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K09160, hypothetical protein (inferred from 100% identity to atu:Atu0932)

Predicted SEED Role

"conserved protein of unknown function; putative YcgN protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UGV3 at UniProt or InterPro

Protein Sequence (159 amino acids)

>Atu0932 hypothetical protein (Agrobacterium fabrum C58)
MNDAPFWKTKSLTEMTGEEWESLCDGCGLCCLNKLEDWDTGEVVFTSVRCVLLDGESCRC
SDYENRRATVPDCIQLDLKKVHEIGWLPPTCAYALVRDGKDLYWWHYLVSGDIETVHEAG
ISARGRTVSEAHVDVDDFEDYVVDWPLTVGEKAGEKQRT