Protein Info for Atu0913 in Agrobacterium fabrum C58

Annotation: Na+/H+ antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details PF01899: MNHE" amino acids 8 to 155 (148 residues), 144.2 bits, see alignment E=1.3e-46

Best Hits

Swiss-Prot: 34% identical to MNHE1_STAEQ: Na(+)/H(+) antiporter subunit E1 (mnhE1) from Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

KEGG orthology group: K05569, multicomponent Na+:H+ antiporter subunit E (inferred from 100% identity to atu:Atu0913)

Predicted SEED Role

"Na(+) H(+) antiporter subunit E" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJR0 at UniProt or InterPro

Protein Sequence (159 amino acids)

>Atu0913 Na+/H+ antiporter (Agrobacterium fabrum C58)
MSLYTVQLVFIAVWLAVTGSLTLANIVFALIVSTLALGLIRHQLPGGRSHWLRLFRVLSL
VLLFFKELALSAWKVAVLVTRPKLDVQPGIFAYPLTVTTDFEITLLANLITLTPGTLSVD
VSADRKTLYVHAIDCSDIEATKNDIRNGFERKIMEAFQI