Protein Info for Atu0907 in Agrobacterium fabrum C58

Annotation: Phosphinothricin acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 4 to 139 (136 residues), 52.9 bits, E=2e-17
• PF13420: Acetyltransf_4
  • amino acids 6 to 157 (152 residues), 72.9 bits, E=9.6e-24
• PF00583: Acetyltransf_1
  • amino acids 18 to 138 (121 residues), 78.6 bits, E=1.4e-25
• PF13673: Acetyltransf_10
  • amino acids 50 to 146 (97 residues), 41.1 bits, E=5.2e-14
• PF13508: Acetyltransf_7
  • amino acids 55 to 139 (85 residues), 51.4 bits, E=3.6e-17
• PF08445: FR47
  • amino acids 86 to 140 (55 residues), 33.9 bits, E=7.8e-12

Best Hits

Swiss-Prot: 60% identical to MDDA_PSEA7: L-methionine sulfoximine/L-methionine sulfone acetyltransferase (PSPA7_5587) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 100% identity to atu:Atu0907)

MetaCyc: 56% identical to L-amino acid N-acyltransferase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]

Predicted SEED Role

"GCN5-related N-acetyltransferase"

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• phosalacine biosynthesis (2/25 steps found)
• phosphinothricin tripeptide biosynthesis (2/25 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1, 2.3.1.183

Use Curated BLAST to search for 2.3.1.1 or 2.3.1.183

Sequence Analysis Tools

See A9CJR4 at UniProt or InterPro

Protein Sequence (165 amino acids)

>Atu0907 Phosphinothricin acetyltransferase (Agrobacterium fabrum C58)
MSVELRDATVDDLSGIMEIYNDAVVNTTAIWNEVVVDLENRKDWFAARTSRGFPVIVAIL
DGKVAGYASYGDWRAFDGYRHTREHSVYVHKDARGHGIGKRLMQALIDHAGGNDVHVLIA
AIEAENTASIRLHESLGFRVVGRFSEVGTKFGRWLDLTCMELKLG