Protein Info for Atu0906 in Agrobacterium fabrum C58

Annotation: Hemolysin III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 50 to 73 (24 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details PF03006: HlyIII" amino acids 20 to 208 (189 residues), 102.3 bits, see alignment E=1.6e-33

Best Hits

Swiss-Prot: 38% identical to YQFA_ECO57: UPF0073 inner membrane protein YqfA (yqfA) from Escherichia coli O157:H7

KEGG orthology group: K11068, hemolysin III (inferred from 100% identity to atu:Atu0906)

Predicted SEED Role

"hemolysin III"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJR5 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Atu0906 Hemolysin III (Agrobacterium fabrum C58)
MSDLWRFGRQYDFYEIVADGIVHGVGIVFALIGATALIFYAMAWGSLSAIAAAWIYGLGL
VACLSVSFTYNIWPHSRVKWFLRRLDHSAIFILIAATYTPFLMRGIHDPLIAVMLGLIWL
AAICGILLKCLFPGRYDRVAIGLYLAMGWSGIMVVEPLSSHLAPVTLWLIVAGGVIYSLG
VIFHVWEKLRFQNAIWHGFVVSAAAVHYFAVVTAFSLVPLAS