Protein Info for Atu0901 in Agrobacterium fabrum C58

Annotation: 6-O-methylguanine-DNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 PF02805: Ada_Zn_binding" amino acids 30 to 91 (62 residues), 84.5 bits, see alignment E=6.2e-28 PF12833: HTH_18" amino acids 125 to 197 (73 residues), 50 bits, see alignment E=4.6e-17 TIGR00589: methylated-DNA--[protein]-cysteine S-methyltransferase" amino acids 284 to 363 (80 residues), 108.5 bits, see alignment E=6.5e-36 PF01035: DNA_binding_1" amino acids 285 to 364 (80 residues), 107.7 bits, see alignment E=3.1e-35

Best Hits

KEGG orthology group: K10778, AraC family transcriptional regulator, regulatory protein of adaptative response / methylated-DNA-[protein]-cysteine methyltransferase [EC: 2.1.1.63] (inferred from 100% identity to atu:Atu0901)

Predicted SEED Role

"ADA regulatory protein / Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63)" in subsystem DNA repair, bacterial (EC 2.1.1.63)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.63

Use Curated BLAST to search for 2.1.1.63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJR7 at UniProt or InterPro

Protein Sequence (378 amino acids)

>Atu0901 6-O-methylguanine-DNA methyltransferase (Agrobacterium fabrum C58)
MPVFRRHASQNCASIPPMMLFKRPDTETLYFALVNKDPAYEGVAYVCVTSTKIFCRFTCT
ARKPKIENCRFRETITECLEAGFRPCKRCKPMLSYGTPDGTVTALLTALENEPARRWREE
DVVALGHDPSTVRRSFKRRFGMSFLEIARLRRVGDAAESLASGEAVIGAQIDAGYESGSG
FRSAINQLFGTSPAAMKGRGFLKGDWIDTPIGPMLAVADDHALHLLEFADRPALPAELKR
LKARTGADMVLGRTAVTGQIAAELAAYFAGRSGSFETRLAGHGTPFERDVWRNLREIPAG
EIVSYSSLATAMERPTAVRAVARANGANQLAIVVPCHRVLGADGSLTGYGGGLWRKKWLI
EHERRMARGQMLGMPLAS