Protein Info for Atu0874 in Agrobacterium fabrum C58

Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF13302: Acetyltransf_3" amino acids 9 to 146 (138 residues), 35 bits, see alignment E=5.7e-12 PF13420: Acetyltransf_4" amino acids 11 to 164 (154 residues), 58.9 bits, see alignment E=1.6e-19 PF00583: Acetyltransf_1" amino acids 49 to 145 (97 residues), 57.6 bits, see alignment E=3.8e-19 PF13673: Acetyltransf_10" amino acids 50 to 150 (101 residues), 35.5 bits, see alignment E=2.4e-12 PF13508: Acetyltransf_7" amino acids 60 to 146 (87 residues), 39.2 bits, see alignment E=1.8e-13

Best Hits

Swiss-Prot: 53% identical to PAT_ALCFA: Phosphinothricin N-acetyltransferase (pat) from Alcaligenes faecalis

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 100% identity to atu:Atu0874)

Predicted SEED Role

"GCN5-related N-acetyltransferase"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.183

Use Curated BLAST to search for 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJT1 at UniProt or InterPro

Protein Sequence (180 amino acids)

>Atu0874 acetyltransferase (Agrobacterium fabrum C58)
MTLSTVSSLLIRPCEEADIPAITEIYRDAVLHGRASFEIDPPDVATMAERRRLLVEGNYP
YLVAEHDGKVAGYAYAGAYRARPAYGATVEDSVYIDPAMKGTGIGRKLLDALIAEATARG
FRQMIAVIGDSANAASVGVHRAAGFELVGTFKSIGWKHGQWLNTVLMQRALGEGDTTPRF