Protein Info for Atu0870 in Agrobacterium fabrum C58

Annotation: trans-aconitate methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF13489: Methyltransf_23" amino acids 14 to 134 (121 residues), 50.8 bits, see alignment E=4.2e-17 PF13847: Methyltransf_31" amino acids 35 to 140 (106 residues), 43.1 bits, see alignment E=9.8e-15 PF08242: Methyltransf_12" amino acids 36 to 125 (90 residues), 43.5 bits, see alignment E=1.1e-14 PF08241: Methyltransf_11" amino acids 36 to 126 (91 residues), 46.5 bits, see alignment E=1.2e-15 PF13649: Methyltransf_25" amino acids 36 to 123 (88 residues), 49 bits, see alignment E=2.1e-16

Best Hits

Swiss-Prot: 100% identical to TAM_AGRFC: Trans-aconitate 2-methyltransferase (tam) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00598, trans-aconitate 2-methyltransferase [EC: 2.1.1.144] (inferred from 100% identity to atu:Atu0870)

MetaCyc: 46% identical to trans-aconitate 2-methyltransferase (Escherichia coli K-12 substr. MG1655)
Trans-aconitate 2-methyltransferase. [EC: 2.1.1.144]

Predicted SEED Role

"Trans-aconitate 2-methyltransferase (EC 2.1.1.144)" (EC 2.1.1.144)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.144

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UH15 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Atu0870 trans-aconitate methyltransferase (Agrobacterium fabrum C58)
MAWSAQQYLKFEDERTRPARDLLAQVPLERVLNGYDLGCGPGNSTELLTDRYGVNVITGI
DSDDDMLEKAADRLPNTNFGKADLATWKPAQKADLLYANAVFQWVPDHLAVLSQLMDQLE
SGGVLAVQMPDNLQEPTHIAMHETADGGPWKDAFSGGGLRRKPLPPPSDYFNALSPKSSR
VDVWHTVYNHPMKDADSIVEWVKGTGLRPYLAAAGEENREAFLADYTRRIAAAYPPMADG
RLLLRFPRLFVVAVKK