Protein Info for Atu0864 in Agrobacterium fabrum C58

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF00106: adh_short" amino acids 7 to 192 (186 residues), 134.2 bits, see alignment E=8.6e-43 PF08659: KR" amino acids 7 to 170 (164 residues), 39.8 bits, see alignment E=9.3e-14 PF01370: Epimerase" amino acids 8 to 142 (135 residues), 21.8 bits, see alignment E=2.2e-08 PF13561: adh_short_C2" amino acids 15 to 197 (183 residues), 74.1 bits, see alignment E=2.7e-24

Best Hits

KEGG orthology group: K14189, uncharacterized oxidoreductase [EC: 1.-.-.-] (inferred from 100% identity to atu:Atu0864)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJT4 at UniProt or InterPro

Protein Sequence (252 amino acids)

>Atu0864 oxidoreductase (Agrobacterium fabrum C58)
MKITGNTILITGGGSGIGRALAEAFHQAGNRVIISGRRQAVLDEVTAANPGMASMVMDAG
DAEGIRAFAEALVKAHPTLNAVINNAGIMRPEEIAAAPDYLDTAEETIATNLLAPIRLTA
ALLPHFLKQPAATVLTVSSGLAFVPMVLTPTYSATKSAIHAYSVALREQLKETSVEVIEI
VPPYVQTTLMGEGQANDERAMPLEAFISEVMDILKNRPDEKEVVVERCKPLRFAAQNGNF
DQVFAMINHMHP