Protein Info for Atu0826 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 603 PF00563: EAL" amino acids 27 to 249 (223 residues), 167.3 bits, see alignment E=5.8e-53 PF00571: CBS" amino acids 287 to 335 (49 residues), 23.9 bits, see alignment 6.6e-09 PF00990: GGDEF" amino acids 422 to 525 (104 residues), 40.3 bits, see alignment E=4.3e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0826)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJU7 at UniProt or InterPro

Protein Sequence (603 amino acids)

>Atu0826 hypothetical protein (Agrobacterium fabrum C58)
MQAVALENDVIRRFASGQMFPMAKLVLETAFQPIVEATTGTIFGYESLMRGHDRLGFSSP
LALLDQAAADGELKAFEQMLASRALAKFSTLPDFSSATLFLNLDVRLIPHGDVILDKLVG
HLARAGIPASSICFELSERFDNTSVPEFTSLIARMRKEGFKLAIDDFGAGHGEMKLLCDF
PLDYLKIDRHFISGIDHLPRKQHLVRNIVNIAHVLGVRVIAEGIETEAEFLSCREFGVDL
VQGWLIAKPTVFTSELPESFPHLNRVGVARRNSQTLDEILIRREIERLPTVFEHDSVDSV
FELFRRNPQQAFFPVLNANGEPRGVINEYHLKEYIYRPFGRDLLKNKIYERTISHFVDPA
PIVGLDADADQLMNMFASMGGMGGSACIILTENMRYAGIVSAASLIKVINEKQLKMAQDQ
NPLTALPGNRAIGGFIADSCSDGDETRFFCYCDFDNFKPFNDKYGFNAGDHAITLFSALM
RRYFFAGDCFLGHIGGDDFFIGVRDWSVEELMEILERLLSDFHDDVAGLYSDEDRAAGCM
KGQDRNGNERDFALLRCSIGVLTLPKGSIIANPERIGSEIASVKAAAKENEGGLVVRVFG
EAN