Protein Info for Atu0821 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 71 to 94 (24 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 196 to 214 (19 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 250 to 275 (26 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 14 to 276 (263 residues), 319.6 bits, see alignment E=1.7e-99 TIGR02139: sulfate ABC transporter, permease protein CysT" amino acids 17 to 280 (264 residues), 407.2 bits, see alignment E=3.4e-126 PF00528: BPD_transp_1" amino acids 84 to 282 (199 residues), 78.3 bits, see alignment E=3.2e-26

Best Hits

Swiss-Prot: 53% identical to CYST_SYNY3: Sulfate transport system permease protein CysT (cysT) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02046, sulfate transport system permease protein (inferred from 100% identity to atu:Atu0821)

MetaCyc: 48% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysU (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysT" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJU9 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Atu0821 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MSNNTSGNRWKWRQSSVIPGFGLTFGYTVTYLFLIILIPLGGLVWSTAKLGFADFIAIAT
DSRTLNALRVSFGTAFIAALVNAVFGVIVAWVLTRYRFPGRRFVDAIVDLPFALPTAVAG
IALTTLYANRGWVGSLFEPFGIKIAFTPTGIVIALIFIGLPFVVRTVQPVMEEIDRQVEE
VAATLGANRFQTITRVLLPSLTPAILTGFALAFARGVGEYGSVIFIAGNIPYVSEIAPLL
IVIRLEEFNYAAATGIATIMLIISFAMLFLINLIQAWSRKRYGYV