Protein Info for Atu0768 in Agrobacterium fabrum C58

Annotation: cytochrome-c oxidase chain I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 transmembrane" amino acids 50 to 71 (22 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 152 to 176 (25 residues), see Phobius details amino acids 201 to 227 (27 residues), see Phobius details amino acids 239 to 265 (27 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 322 to 345 (24 residues), see Phobius details amino acids 359 to 381 (23 residues), see Phobius details amino acids 393 to 414 (22 residues), see Phobius details amino acids 430 to 451 (22 residues), see Phobius details amino acids 464 to 486 (23 residues), see Phobius details amino acids 511 to 531 (21 residues), see Phobius details TIGR02891: cytochrome c oxidase, subunit I" amino acids 40 to 567 (528 residues), 723.4 bits, see alignment E=7e-222 PF00115: COX1" amino acids 48 to 515 (468 residues), 529.3 bits, see alignment E=4e-163

Best Hits

Swiss-Prot: 80% identical to COX1_BRADU: Cytochrome c oxidase subunit 1 (ctaD) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02274, cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 100% identity to atu:Atu0768)

Predicted SEED Role

"Cytochrome c oxidase polypeptide I (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U5I4 at UniProt or InterPro

Protein Sequence (569 amino acids)

>Atu0768 cytochrome-c oxidase chain I (Agrobacterium fabrum C58)
MAGPSAHDDHHSHGQSAHDAHAHDDHSHDHSHKPGFFARWFLSTNHKDIGTLYLIFAIMA
GIIGGGLSVVMRMELQEPGIQIFHGLASMVYGFEGDAAIDGGKHMFNVFTTAHALIMIFF
MVMPAMIGGFANWMIPIMIGAPDMAFPRLNNISFWLIVPAFILLLLSLFVEGPAGAYGVG
GGWTMYPPLSTSGMPGPAVDLAIFSLHVAGASSILGAINFITTILNMRAPGMTLHKMPLF
AWSVLVTAFLLLLSLPVLAGGITMLLTDRNFGTAFFSPEGGGDPILYQHLFWFFGHPEVY
ILILPGFGIISHIVSTFSKKPVFGYLGMAYAMVAIGAVGFIVWAHHMYTVGLSLEAQRYF
VFATMVIAVPTGIKIFSWIATMWGGSLTFSTPMVWAIGFIFLFTVGGVTGVQLANAGLDR
SLHDTYYVVAHFHYVLSLGAVFAIFAGWYYWFPKITGYMYNEFIGKLHFWVMFIGVNLIF
FPQHFLGLAGMPRRYIDYPDAYAGWNMVSSYGSYISAVAVGIFLFGVWEAFAKKRIAGNN
PWGEGATTLEWQLSSPPPYHQWEQLPRIR