Protein Info for Atu0761 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details amino acids 27 to 31 (5 residues), see Phobius details transmembrane" amino acids 37 to 56 (20 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 120 to 148 (29 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details PF01925: TauE" amino acids 3 to 228 (226 residues), 85.6 bits, see alignment E=2.3e-28

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to atu:Atu0761)

Predicted SEED Role

"FIG00985104: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D0R0 at UniProt or InterPro

Protein Sequence (239 amino acids)

>Atu0761 hypothetical protein (Agrobacterium fabrum C58)
MFAGAACLAGLARGFSGFGAALIFIPLASAIVGPRIASAVLLVVDGVLTLGMIPPAFRMA
DRREVFIMAAGAFVGVPIGTLLLSKGDPLTLRWLISGVVVVLLVFLVSGWRYSGRPKTPL
TLFTGLLAGLFSGAAQLGGPPVVAYWLGGALKGAFVRANVILYFAVSTVFSIASYFVSGL
FTVDVFVFFLLALPFYAVGLYAGARLHGLADEAAFRRICYGLIAISAVIGLPLFDSLLK