Protein Info for Atu0750 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 21 to 51 (31 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 168 to 181 (14 residues), see Phobius details PF02361: CbiQ" amino acids 11 to 199 (189 residues), 36.9 bits, see alignment E=1.6e-13

Best Hits

Swiss-Prot: 56% identical to BION_RHIEC: Energy-coupling factor transporter transmembrane protein BioN (bioN) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K02008, cobalt/nickel transport system permease protein (inferred from 100% identity to atu:Atu0750)

Predicted SEED Role

"Transmembrane component BioN of energizing module of biotin ECF transporter" in subsystem Biotin biosynthesis or ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJY3 at UniProt or InterPro

Protein Sequence (210 amino acids)

>Atu0750 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MKSLHVEGTGWFYRVSPRLKLLTLMGFSIALFLTRDLVLLGCAAILAAVILRETRLPFRE
IGVRLRPVMLTIFLVAAFSYLLLPAQDASVNLLRLTALALLATAVTITVSISAFMDEITL
ATAPLERLGLVKAADIGLAVGLVVRFVPEIVNRYHAVRDAHRARGLPVRMATIIVPLVIM
TLKDADAIADAIDARGFRGQSFRPDNHPEF