Protein Info for Atu0717 in Agrobacterium fabrum C58

Annotation: ATP synthase B chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details PF00430: ATP-synt_B" amino acids 13 to 136 (124 residues), 77.6 bits, see alignment E=9.7e-26 PF05405: Mt_ATP-synt_B" amino acids 14 to 94 (81 residues), 32.2 bits, see alignment E=8.5e-12

Best Hits

Swiss-Prot: 100% identical to ATPF1_AGRFC: ATP synthase subunit b 1 (atpF1) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02109, F-type H+-transporting ATPase subunit b [EC: 3.6.3.14] (inferred from 100% identity to atu:Atu0717)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CK01 at UniProt or InterPro

Protein Sequence (161 amino acids)

>Atu0717 ATP synthase B chain (Agrobacterium fabrum C58)
MAFDASFFALVGLVLFFVLIAYLKVPGMLSKSLDERAQNIQDELAEAKRLREEAQHLLAE
YQRKRKEAEAEAAGIVAAAEREAAALTEEAKQKTEEFVARRTALSEQKIKQAEEDAIGAV
RAAAVDIAIAASEKLLAEKTTAAAKAKLFAATIGEVKSKLN