Protein Info for Atu0716 in Agrobacterium fabrum C58

Annotation: ATP synthase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 transmembrane" amino acids 58 to 76 (19 residues), see Phobius details PF02326: YMF19" amino acids 53 to 125 (73 residues), 33 bits, see alignment E=9.1e-12 PF00430: ATP-synt_B" amino acids 63 to 190 (128 residues), 63.5 bits, see alignment E=2.2e-21

Best Hits

Swiss-Prot: 100% identical to ATPF2_AGRFC: ATP synthase subunit b 2 (atpF2) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02109, F-type H+-transporting ATPase subunit b [EC: 3.6.3.14] (inferred from 100% identity to atu:Atu0716)

Predicted SEED Role

"ATP synthase F0 sector subunit b' (EC 3.6.3.14)" (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D0U9 at UniProt or InterPro

Protein Sequence (213 amino acids)

>Atu0716 ATP synthase B (Agrobacterium fabrum C58)
MFVTEAYAQSAPTVGETHTETPAVGQPQPEATHTETGVAHGAEHGASGVFPPFDQSTYAS
QVLWLAITFGLFYLLMQKVIVPRVGGILENRHGRIAQDLDEAARLKAEADTAVETYEKEL
AAARAKASSIGASARDAAKAKADADRAAIEAGLAEKLAAAEKRIAGIRDHAFADVGAIAE
ETATAIVDQLVGAKVKDTDVKAAIAAASAVKGA