Protein Info for Atu0709 in Agrobacterium fabrum C58

Annotation: mrp protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 PF01883: FeS_assembly_P" amino acids 6 to 73 (68 residues), 50.8 bits, see alignment E=5.1e-17 PF10609: ParA" amino acids 128 to 370 (243 residues), 341.7 bits, see alignment E=7.3e-106 PF09140: MipZ" amino acids 131 to 256 (126 residues), 33.9 bits, see alignment E=6.3e-12 PF13614: AAA_31" amino acids 131 to 168 (38 residues), 36.2 bits, see alignment 1.8e-12 PF01656: CbiA" amino acids 132 to 349 (218 residues), 47.8 bits, see alignment E=4.2e-16

Best Hits

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 100% identity to atu:Atu0709)

Predicted SEED Role

"Scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D0V6 at UniProt or InterPro

Protein Sequence (388 amino acids)

>Atu0709 mrp protein (Agrobacterium fabrum C58)
MAEVSKNQVEKALETVIYPGSGKNIVALGMVSEIFIADAKAYFSITVPADKASEMEPLRL
AAERAAKSVEGIAGAVVALTADRKPGQQQPAPAGPTPARPAAATGRPAAAPGRPTPQPGS
SKVGVPGVRAIIAVASGKGGVGKSTTAVNLALGLQALGLKVGMLDADIYGPSLPRLLKIS
GRPKQQEDRIILPMENYGLKVMSMGFLVDEEAAMIWRGPMVQSALMQMLREVAWGELDVL
VLDMPPGTGDAQLTIAQQVPLAGAVIVSTPQDLALLDARKGITMFRKVEVPLLGVIENMS
YFIAPDTGARYDIFGHGGAKAEAERIGVPFLGEVPLTISIREMSDAGTPVVVAEPDGPQA
AIYREIAEKVWARMGADERKAAPKIVFE