Protein Info for Atu0697 in Agrobacterium fabrum C58

Annotation: tetraacyldisaccharide 4'-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 14 to 31 (18 residues), see Phobius details TIGR00682: tetraacyldisaccharide 4'-kinase" amino acids 17 to 300 (284 residues), 179.5 bits, see alignment E=4.4e-57 PF02606: LpxK" amino acids 17 to 318 (302 residues), 297.3 bits, see alignment E=6.8e-93

Best Hits

Swiss-Prot: 100% identical to LPXK_AGRFC: Tetraacyldisaccharide 4'-kinase (lpxK) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00912, tetraacyldisaccharide 4'-kinase [EC: 2.7.1.130] (inferred from 100% identity to atu:Atu0697)

MetaCyc: 51% identical to tetraacyldisaccharide 4'-kinase (Brucella abortus 2308)
Tetraacyldisaccharide 4'-kinase. [EC: 2.7.1.130]

Predicted SEED Role

"Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130)" in subsystem KDO2-Lipid A biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 2.7.1.130)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.130

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UHI5 at UniProt or InterPro

Protein Sequence (348 amino acids)

>Atu0697 tetraacyldisaccharide 4'-kinase (Agrobacterium fabrum C58)
MVSEAPPFWWQKAGWQAWLLSPFSLLYGKVAGRRMRTAKRANVPVPVICIGNFTVGGAGK
TPTAIAIARAAVARGMKPGFLSRGYGGTLDVTTLVDAQHHRAAAVGDEPLLLAREAVTVI
SRRRVEGAHRLVKEGVNLIIMDDGFQSARLTLDYALVVIDTVRGIGNGHLVPGGPVRAPL
AEQMRQMTGLLKVGKGHAADPLVRQAAKAAKPVFVAAIMPQEPEDFRGKRVLAFAGIADP
AKFYRTVEALGGDIVLSRSFPDHHHFSDDEIDDLLKDARKENLQLVTTAKDAVRLNGHHG
RAEELLWNSQVIEIDMVFDDPNAAGTVIETAVVNCRARLLRDNARSST