Protein Info for Atu0696 in Agrobacterium fabrum C58

Annotation: phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF00702: Hydrolase" amino acids 13 to 205 (193 residues), 83.3 bits, see alignment E=6.3e-27 PF12710: HAD" amino acids 16 to 202 (187 residues), 30.8 bits, see alignment E=7.9e-11 PF13419: HAD_2" amino acids 96 to 206 (111 residues), 68.9 bits, see alignment E=1.3e-22 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 116 to 205 (90 residues), 43.1 bits, see alignment E=2.8e-15 PF13242: Hydrolase_like" amino acids 168 to 234 (67 residues), 43.7 bits, see alignment E=4.3e-15

Best Hits

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 100% identity to atu:Atu0696)

Predicted SEED Role

"Hydrolase, haloacid dehalogenase-like family"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CK10 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Atu0696 phosphatase (Agrobacterium fabrum C58)
MVADIELDAAQSIAAVLFDKDGTLLGYDASWGPVNRELASIAAKGDAALADRLLAACGMD
PVTGHVVPDSLLAAGNTAEIAAGLVAAGSSCDVVELTQRLDRLFTEAADKSVPVTDLKAF
FARLKARGYKLGIASSDNENSIRQTAIRFGFEEDIDFVAGYDSGYGTKPQPGMVLGFCEA
IGFPPERVAVVGDNNHDLHMAKNAGAGLRIAVLTGTGSRESLGADAHYCFDDITGLEALL
PERAV