Protein Info for Atu0693 in Agrobacterium fabrum C58

Annotation: PmbA/TldD related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF01523: PmbA_TldD_1st" amino acids 29 to 91 (63 residues), 48.7 bits, see alignment E=1e-16 PF19290: PmbA_TldD_2nd" amino acids 120 to 223 (104 residues), 48.8 bits, see alignment E=1.3e-16 PF19289: PmbA_TldD_3rd" amino acids 234 to 447 (214 residues), 226 bits, see alignment E=5.3e-71

Best Hits

KEGG orthology group: K03592, PmbA protein (inferred from 100% identity to atu:Atu0693)

Predicted SEED Role

"TldE protein, part of TldE/TldD proteolytic complex"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D0X0 at UniProt or InterPro

Protein Sequence (448 amino acids)

>Atu0693 PmbA/TldD related protein (Agrobacterium fabrum C58)
MSSEIDSSKLLDRASQLVDLARAAGADEADAVVVRSRSQSVGVRLGKVESTESSESDDFS
LRVFVGRRVASVSANPGFDLKTLAERAVAMAKVSPEDPFACLADKQRLATSYDDLQLFDA
TEVSADQLREAALASEEAALAVKGVSNSSGAGASSGMGGLVLVTSHGFSGSYMGSRFGRS
VSVIAGEGTKMERDYDYDSRLYYADLDTAEEIGRRAGEKVVRRVGPRQVDTGSNITVVFD
PRIARGFVGAIAGAINGASVARKTSFLRDKMGQQILKKGLYLTDDPQIVRGPSSRPFDGE
GIRGEKMTMIEDGVLKHWFLSTSAARELGLETNGRGVRGGTSVSPASTNLALEPGDLSPE
ELLVQIGTGFYVTELIGHGANMLTGEYSCGASGFWIENGEKSFPVSEVTIASNLKDMFMR
VTPANDIDRKYGVAAPTLAIEGMTIAGK