Protein Info for Atu0688 in Agrobacterium fabrum C58

Annotation: cytidine and deoxycytidylate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00383: dCMP_cyt_deam_1
  • amino acids 3 to 101 (99 residues), 90.8 bits, E=4.7e-30
• PF14437: MafB19-deam
  • amino acids 4 to 149 (146 residues), 121.6 bits, E=2.3e-39

Best Hits

Swiss-Prot: 100% identical to TADA_AGRFC: tRNA-specific adenosine deaminase (tadA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 100% identity to atu:Atu0688)

MetaCyc: 42% identical to tRNA adenosine34 deaminase (Escherichia coli K-12 substr. MG1655)
3.5.4.-

Predicted SEED Role

"tRNA-specific adenosine-34 deaminase (EC 3.5.4.-)" in subsystem tRNA processing (EC 3.5.4.-)

KEGG Metabolic Maps

• Atrazine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.-

Sequence Analysis Tools

See A9CK16 at UniProt or InterPro

Protein Sequence (152 amino acids)

>Atu0688 cytidine and deoxycytidylate deaminase (Agrobacterium fabrum C58)
MAERTHFMELALVEARSAGERDEVPIGAVLVLDGRVIARSGNRTRELNDVTAHAEIAVIR
MACEALGQERLPGADLYVTLEPCTMCAAAISFARIRRLYYGAQDPKGGAVESGVRFFSQP
TCHHAPDVYSGLAESESAEILRQFFREKRLDD