Protein Info for Atu0671 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 60 (18 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 96 to 119 (24 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 221 to 239 (19 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 8 to 283 (276 residues), 221 bits, see alignment E=8.9e-70

Best Hits

Swiss-Prot: 100% identical to Y671_AGRFC: UPF0324 membrane protein Atu0671 (Atu0671) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 100% identity to atu:Atu0671)

Predicted SEED Role

"Putative membrane protein YeiH" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D0Y8 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Atu0671 hypothetical protein (Agrobacterium fabrum C58)
MRIAGHAWLGDLVLAILIGTLLRSLVSLPVVASAGIKFSAKTLLEIAVALLGASLSLSIL
KGAGGLLIGGIALIVALSLVFSYAAGRMLGLPPKLATLIACGNSICGNSAIAAAAPAIGA
KPEDVAASIAFTAVLGVVAVLLMPFLPQLLGLDATQYGIFAGLTVYAVPQVLAATAPLGA
VAVQTGTIVKLIRVLMLGPVIATLSVIHGQSGKGRLKLQQMVPWFIIGFVLMIMARSFGL
IPEALLSPVASLSNILTIMSMAALGLSVDIRSLRHAGGKVIIAASLSLVLLGVLSFGLIL
LTQAA