Protein Info for Atu0661 in Agrobacterium fabrum C58

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 PF00862: GT-B_Sucrose_synth" amino acids 12 to 48 (37 residues), 25.7 bits, see alignment 1.5e-09 PF13579: Glyco_trans_4_4" amino acids 34 to 216 (183 residues), 70.5 bits, see alignment E=6.6e-23 PF13439: Glyco_transf_4" amino acids 34 to 221 (188 residues), 86.5 bits, see alignment E=6.6e-28 PF20706: GT4-conflict" amino acids 172 to 365 (194 residues), 55.5 bits, see alignment E=1.5e-18 PF00534: Glycos_transf_1" amino acids 240 to 390 (151 residues), 108 bits, see alignment E=1.2e-34 PF13692: Glyco_trans_1_4" amino acids 242 to 381 (140 residues), 99.4 bits, see alignment E=6.5e-32

Best Hits

Swiss-Prot: 100% identical to MFPS_AGRFC: Mannosylfructose-phosphate synthase (mfpsA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K13058, mannosylfructose-phosphate synthase [EC: 2.4.1.246] (inferred from 100% identity to atu:Atu0661)

MetaCyc: 100% identical to mannosylfructose-phosphate synthase (Agrobacterium fabrum C58)
Mannosylfructose-phosphate synthase. [EC: 2.4.1.246]

Predicted SEED Role

"Mannosylfructose-phosphate synthase mfpsA"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.246

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A7TZT2 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Atu0661 glycosyltransferase (Agrobacterium fabrum C58)
MTTTSETERYPRIALISTHGYVAAHPPLGAADTGGQVVYVLELARKLGQLGYTVDLYTRR
FEDQPEFDEVDERVRVVRIPCGGRDFIPKEYLHRHLMEWCENALRFIKKNDLNYSFINSH
YWDAGVAGQRLSEALKIPHLHTPHSLGIWKKRQMETDYPEKADTFELEFNFKERIQHELI
IYRSCDMVIATTPVQLDVLIEDYGLKRKHIHMIPPGYDDNRFFPVSDATRQMIRQRFGFE
GKVVLALGRLATNKGYDLLIDGFSVLAEREPEARLHLAVGGENMDEQETTILNQLKERVK
SLGLEDKVAFSGYVADEDLPDIYRAADLFVLSSRYEPFGMTAIEAMASGTPTVVTIHGGL
FRAISYGRHALFADPFDKEDLGITMMKPFKHERLYGRLSRMGAHKARSLFTWTGIAQQLL
ALVEGRTMMPVLEEADWAEPWNDGD