Protein Info for Atu0657 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 TIGR00046: RNA methyltransferase, RsmE family" amino acids 8 to 237 (230 residues), 138.4 bits, see alignment E=1.3e-44 PF20260: PUA_4" amino acids 19 to 64 (46 residues), 55.3 bits, see alignment 5.6e-19 PF04452: Methyltrans_RNA" amino acids 75 to 232 (158 residues), 158.1 bits, see alignment E=1.6e-50

Best Hits

KEGG orthology group: K09761, ribosomal RNA small subunit methyltransferase E [EC: 2.1.1.-] (inferred from 100% identity to atu:Atu0657)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D102 at UniProt or InterPro

Protein Sequence (239 amino acids)

>Atu0657 hypothetical protein (Agrobacterium fabrum C58)
MQRLFIEASLSEGVAQEATGEQFNYLANVLRMTDGAEILLFNGRDGEWKAKLSFPSRKKI
SLVPLEQTRPQPDAAELHYLFAPLKVGRMDYLVQKAVEMGAGLLQPVMTQHVQGKIHNSE
KLRANAIEAAEQCGILSLPEVAEPVKLKEMLETWPEDRRIIYCDEGDAGQNPLPILQAVK
ERKIALLVGPEGGFSEEERALLRSLAFVTPIPLGPRILRADTAAVAALAVIQAVIGDWN