Protein Info for Atu0631 in Agrobacterium fabrum C58

Annotation: molybdenum cofactor biosynthesis protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 TIGR02667: molybdenum cofactor biosynthesis protein B" amino acids 16 to 178 (163 residues), 266.3 bits, see alignment E=7.9e-84 TIGR00177: molybdenum cofactor synthesis domain" amino acids 22 to 160 (139 residues), 129.4 bits, see alignment E=1e-41 PF00994: MoCF_biosynth" amino acids 23 to 164 (142 residues), 127.7 bits, see alignment E=1.5e-41

Best Hits

Swiss-Prot: 50% identical to MOAB_ECOLI: Molybdenum cofactor biosynthesis protein B (moaB) from Escherichia coli (strain K12)

KEGG orthology group: K03638, molybdenum cofactor biosynthesis protein B (inferred from 100% identity to atu:Atu0631)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaB" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CK44 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Atu0631 molybdenum cofactor biosynthesis protein B (Agrobacterium fabrum C58)
MRAGYFEDKAIAGDRPFIPLGIAVLTVSDSRTLENDKSGDTLVARLEEAGHRLAARAIVP
DDKAAIAETVREWTLSEGVDVVITTGGTGFTGRDVTPEALEPLFEKRMDGFSALFHRISY
DKIGTATIQSRATGGVANATFIFVLPGSPGACKDAWDGILKAQLDYRHLPCNFVEIMPRL
DEHLKRGKS