Protein Info for Atu0613 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 33 to 55 (23 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details amino acids 269 to 294 (26 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 348 to 371 (24 residues), see Phobius details amino acids 383 to 403 (21 residues), see Phobius details amino acids 441 to 462 (22 residues), see Phobius details amino acids 468 to 487 (20 residues), see Phobius details amino acids 498 to 517 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 46 to 235 (190 residues), 45.5 bits, see alignment E=3.6e-16 amino acids 336 to 515 (180 residues), 27.7 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 100% identity to atu:Atu0613)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D136 at UniProt or InterPro

Protein Sequence (526 amino acids)

>Atu0613 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MPILAIFWLALTGSTEGWQHLLANVLPRAGFRTFILLGLTAATTAFFGIVCAWLVTTFEF
PLRRILSAALVLPLAIPSYLAAYAFGEFLDFTGPVQSAVRAAFGYHSIRDYWFPDIRSLG
GAVIVLSSVLYPYVYLSARAALSMQGRFAAEAARTLGAKPLNVFFSVQLPMARPAIAIGL
SLVLMETLNDIGAVEYLGVQTLTFTIYETWLNRGNLANATQIAAVILIIVSALIVIERNA
REKQRFGAPKATSMAQRHRLKALAGWRRWCASLFCFLPVASGFFIPVIVLGGYAAKRLDA
LFQPKLLKALGHSLEVSLSAAFLTLIAAFVFSYAIRTERSRLSKVAARLGSMGYGVPGTV
LAIGVLIPLASLDNGVDGFIRSHFGFSSGLLLSGTAFAIIYAHAVRFMTMAEGTLDAGFH
KLSPHIDMASRSLGRNRAQTLFKVLLPNMRPAALTAFLLVLIESMKELPATILLRPFGFN
TLATLVYEDASRSRVQDAAVPAIIIIMAGLIPVLLVSKSMDHPEHH