Protein Info for Atu0607 in Agrobacterium fabrum C58

Annotation: isocitrate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 PF00463: ICL" amino acids 14 to 243 (230 residues), 181.6 bits, see alignment E=2.4e-57 amino acids 242 to 424 (183 residues), 172.9 bits, see alignment E=1e-54 TIGR01346: isocitrate lyase" amino acids 14 to 243 (230 residues), 314.6 bits, see alignment E=5.4e-98 PF13714: PEP_mutase" amino acids 70 to 227 (158 residues), 55.3 bits, see alignment E=7.3e-19

Best Hits

Swiss-Prot: 70% identical to ACEA_BACHD: Isocitrate lyase (aceA) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K01637, isocitrate lyase [EC: 4.1.3.1] (inferred from 100% identity to atu:Atu0607)

MetaCyc: 67% identical to isocitrate lyase subunit (Mycobacterium tuberculosis H37Rv)
Isocitrate lyase. [EC: 4.1.3.1]

Predicted SEED Role

"Isocitrate lyase (EC 4.1.3.1)" in subsystem Serine-glyoxylate cycle (EC 4.1.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CK53 at UniProt or InterPro

Protein Sequence (429 amino acids)

>Atu0607 isocitrate lyase (Agrobacterium fabrum C58)
MTDFYKLVPGAPKGRFDGIERTYTAADVARLRGSVEIRHSLAEMGANRLWKLINEENFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAAPELAKRINRT
LQRADQIETAEGKGLSVDTWFAPIVADAEAGFGGPLNAFEIMKAFIEAGAAGVHYEDQLA
SEKKCGHLGGKVLIPTAAHIRNLTAARLAADVMGVPTLVIARTDAEAAKLLTSDIDERDQ
PFVDYDAGRTVEGFYQVKNGLEPCIARAVAYAPYCDLIWCETSKPDLEQARRFAEGVHKV
HPGKKLAYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHQLNFGMFELARG
YKDRQMAAYSELQEAEFAAEVNGYTATKHQREVGTGYFDAVSLAISGGTSSTTAMKESTE
HDQFRPAAE