Protein Info for Atu0595 in Agrobacterium fabrum C58

Annotation: ABC transporter, nucleotide binding/ATPase protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 PF00005: ABC_tran" amino acids 19 to 161 (143 residues), 121.7 bits, see alignment E=5.3e-39 PF17912: OB_MalK" amino acids 236 to 288 (53 residues), 36.2 bits, see alignment 1.4e-12 PF08402: TOBE_2" amino acids 282 to 353 (72 residues), 32.8 bits, see alignment E=9.1e-12

Best Hits

Swiss-Prot: 78% identical to AGLK_RHIME: Alpha-glucoside transport ATP-binding protein AglK (aglK) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K10235, alpha-glucoside transport system ATP-binding protein (inferred from 100% identity to atu:Atu0595)

Predicted SEED Role

"Alpha-glucoside transport ATP-binding protein AglK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CK57 at UniProt or InterPro

Protein Sequence (362 amino acids)

>Atu0595 ABC transporter, nucleotide binding/ATPase protein (Agrobacterium fabrum C58)
MTSLVLKDIRKSYGQVKVLHGIDLQIEQGEFIVFVGPSGCGKSTLLRMIAGLEEITGGEM
FIDGQLVNEIPPSRRGIAMVFQSYALYPHMTVYDNMAFGMKIAKENKQEIDRRVRAAAEI
LQLTQYLERLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAKLN
EQMADTTMIYVTHDQVEAMTLADRIVVLNAGRVEQVGPPLELYERPANLFVAKFIGSPAM
NIIAAKIVGTGERTSIELAGGKTLAVDVPTPATEQGKAASFGVRPEDLSIVTGDDYLFEG
KVAIVEALGEVTLLYLEAPKGQEPIIVKVPGIVSVGKGETLRFAAPQEKLHLFDAAGKTY
RP