Protein Info for Atu0587 in Agrobacterium fabrum C58

Annotation: teichoic acid biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF03808: Glyco_tran_WecG" amino acids 71 to 219 (149 residues), 61.9 bits, see alignment E=3.5e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0587)

Predicted SEED Role

"N-acetylmannosaminyltransferase (EC 2.4.1.187)" in subsystem Teichoic and lipoteichoic acids biosynthesis (EC 2.4.1.187)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.187

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CK61 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Atu0587 teichoic acid biosynthesis protein (Agrobacterium fabrum C58)
MNFASGVTRRGLQRNIHGLRVCDLDWNGALELVSGKASACEGHTMLSFLTIEKTKLSLKD
NAYRQILESCLLLPQGKGMKAAARAEHGEPLPATIDGVAFTMALLTYMAVPKRIGVAGDD
AAQIGEVLARLRAHAPWHDFVMLNRDAAGVKVDVLLAGMLKENQETWLHRSVSREDARVT
IAVGPLFKVLSSEVAGMPDIFRKLHMSWLYSLCAEPWHIALGKS