Protein Info for Atu0564 in Agrobacterium fabrum C58

Annotation: flagellar biosynthetic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 34 to 52 (19 residues), see Phobius details amino acids 82 to 108 (27 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details TIGR00328: flagellar biosynthetic protein FlhB" amino acids 8 to 353 (346 residues), 393.2 bits, see alignment E=5.5e-122 PF01312: Bac_export_2" amino acids 9 to 348 (340 residues), 373.2 bits, see alignment E=6.5e-116

Best Hits

Swiss-Prot: 64% identical to FLHB_RHIME: Flagellar biosynthetic protein FlhB (flhB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 100% identity to atu:Atu0564)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D181 at UniProt or InterPro

Protein Sequence (360 amino acids)

>Atu0564 flagellar biosynthetic protein (Agrobacterium fabrum C58)
MADDQDKDSKTEDPTEKKLRDAAEKGNLPFSREVPIFASSLAFYCYLVFFLPEGAGRLGV
TLKDLFGQPEQWNLSTRPDALALLYFLGTSVAYLLMPAMIMFIVFGLASSFLQNLPSPVL
ERVRPQWSRISPAKGFTRIYSKQGFVEFAKSVFKIMIVSIIMFFALRGDFYSLIDLMFSD
PQVIFVRVVEIVKKMMVVILLSTALLAAVDVLWTRHHWFSQLKMTKHEVKEEYKQSQGDP
VVKSRQRSIARDRARRRMINNVPRATLVIANPTHFAVALRYVREEGDAPVVVAKGQDLIA
LKIRQIAEENNIPVFEDPPLARSMFAQVSVDSVIPPVFYKAVAELVHRVYARTSSKIRVQ