Protein Info for Atu0563 in Agrobacterium fabrum C58

Annotation: flagellar motor switch protein FliG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF14842: FliG_N" amino acids 16 to 108 (93 residues), 58.2 bits, see alignment E=2.3e-19 PF14841: FliG_M" amino acids 128 to 198 (71 residues), 67.6 bits, see alignment E=1.9e-22 PF01706: FliG_C" amino acids 228 to 335 (108 residues), 77.5 bits, see alignment E=1.8e-25

Best Hits

Swiss-Prot: 100% identical to FLIG_AGRFC: Flagellar motor switch protein FliG (fliG) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02410, flagellar motor switch protein FliG (inferred from 100% identity to atu:Atu0563)

Predicted SEED Role

"Flagellar motor switch protein FliG" in subsystem Bacterial Chemotaxis or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q44458 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Atu0563 flagellar motor switch protein FliG (Agrobacterium fabrum C58)
MMDFEDFGNPLAGKPLSQADKAAAVLLAMGKGVAGKLLKFFTQHELQMIISSAQTLRVIP
PDELAQIVAEFEDLFTEGTGLMDNAKAIESILEEGLTPEEVDSLLGRRAAFQAYEASIWD
RLQEAEPEFVGKFLLREHPQTIAYILSMLPSSFGAKVLLTIPEEQRADIMNRTVNMKEVS
PTAAQIIEKRVVNLINEIEAERNAGGSTKVADLMNELDKPQVDTLLSSLETLSKEAANKV
KPKIFLFDDLMFMPQRSRVLLLNDVSADVLTMALRGATVEIKECVLSSISPRQRRMIESD
LAVPQASLNTREVAIARRAVAQEAIRLANSGQIQLKDVAAEEQSAAA