Protein Info for Atu0560 in Agrobacterium fabrum C58

Annotation: flagellar motor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details amino acids 23 to 23 (1 residues), see Phobius details transmembrane" amino acids 7 to 22 (16 residues), see Phobius details amino acids 32 to 49 (18 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 197 to 220 (24 residues), see Phobius details TIGR03818: flagellar motor stator protein MotA" amino acids 1 to 281 (281 residues), 357.9 bits, see alignment E=1.6e-111 PF20560: MotA_N" amino acids 4 to 92 (89 residues), 114.7 bits, see alignment E=1.9e-37 PF01618: MotA_ExbB" amino acids 135 to 227 (93 residues), 47 bits, see alignment E=2.2e-16

Best Hits

Swiss-Prot: 100% identical to MOTA_AGRFC: Motility protein A (motA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 99% identity to agr:AGROH133_03955)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q44456 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Atu0560 flagellar motor protein (Agrobacterium fabrum C58)
MNIVIGLIITFGCIIGGYMAMGGHLNVLVQPFELMIIGGAGLGGFIMANPMKVVKDSGKA
LGEAFKHSVPKERNYLDVLGVLYSLMRDLRTKSRNEIEAHIDNPEESSIFQSAPSVLKNK
ELTSFICDYVRLIIIGNARSHEIEALMDEEIETILHDKLKPYHAITTMGDSFPAIGIVAA
VLGVIKAMGKINESPEVLGGLIGAALVGTMLGIILSYSICNPLASQVKIVRTKQHRLYII
VKQTLIAYMNGSVPQVALEYGRKTISNYERPSIDAVEQEMMNPGGENKAA