Protein Info for Atu0552 in Agrobacterium fabrum C58

Annotation: flagellar basal-body rod protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details TIGR02488: flagellar basal-body rod protein FlgG" amino acids 3 to 260 (258 residues), 363.6 bits, see alignment E=6.2e-113 TIGR03506: flagellar hook-basal body protein" amino acids 3 to 136 (134 residues), 162 bits, see alignment E=3.3e-51 amino acids 146 to 243 (98 residues), 106.1 bits, see alignment E=3.1e-34 PF00460: Flg_bb_rod" amino acids 5 to 34 (30 residues), 43.3 bits, see alignment 4.2e-15 PF22692: LlgE_F_G_D1" amino acids 96 to 159 (64 residues), 81.5 bits, see alignment E=6.1e-27 PF06429: Flg_bbr_C" amino acids 215 to 257 (43 residues), 76 bits, see alignment 2e-25

Best Hits

Swiss-Prot: 100% identical to FLGG_AGRFC: Flagellar basal-body rod protein FlgG (flgG) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02392, flagellar basal-body rod protein FlgG (inferred from 100% identity to atu:Atu0552)

Predicted SEED Role

"Flagellar basal-body rod protein FlgG" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q44338 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Atu0552 flagellar basal-body rod protein (Agrobacterium fabrum C58)
MRALAIAATGMDAQQTNLEVIANNIANINTTGYKRARAEFTDLLYQTERMQGVPNRANQA
IVPEGANIGLGVQTSAVRNIHTQGNLIETGNKLDVAIIGQGWFQIEAADGSTLYSRAGAF
NKNADGNLVTVDGYNVIPNINIPTDAQDITITRTGQVTARIGNAADFTQLGQLTIANFAN
EAGLKPLGDNLFSQTPASGAPVVGVPDDPSYGYVKQSYLEGSNVDAVKEITDLITAQRAY
EMNSKVITTADEMASIVSKNLK