Protein Info for Atu0527 in Agrobacterium fabrum C58

Annotation: two component sensor kinase/response regulator hybrid

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1100 1169 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 41 to 64 (24 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details amino acids 286 to 311 (26 residues), see Phobius details amino acids 332 to 360 (29 residues), see Phobius details amino acids 388 to 406 (19 residues), see Phobius details amino acids 414 to 439 (26 residues), see Phobius details amino acids 446 to 464 (19 residues), see Phobius details amino acids 498 to 518 (21 residues), see Phobius details PF12860: PAS_7" amino acids 651 to 760 (110 residues), 115.2 bits, see alignment E=3.6e-37 PF00512: HisKA" amino acids 802 to 866 (65 residues), 33.4 bits, see alignment 7.7e-12 PF02518: HATPase_c" amino acids 911 to 1019 (109 residues), 89.9 bits, see alignment E=3e-29 PF00072: Response_reg" amino acids 1046 to 1157 (112 residues), 40.2 bits, see alignment E=7.1e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0527)

Predicted SEED Role

"Na+/proline symporter / Sensor histidine kinase PrlS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CK74 at UniProt or InterPro

Protein Sequence (1169 amino acids)

>Atu0527 two component sensor kinase/response regulator hybrid (Agrobacterium fabrum C58)
MLPGWIIFGSAFAYILLLFAVASYGDRKSRDRHAPKKGRPFVYALSLAIYCTSWTYFGGV
GLAADKGLEFLGIYTGPILAFTLGMPIIRRIVDLAKTEKLTSVADFIAARYGKNSTVAMI
VAIIALVGAIPYIALQLKAVSSSVATMVDPGDYGIGSGNLYFLDLPLVVTLVMAGFAVMF
GTRHTDATEHQDGLILAISMESLVKLVAMCTVGFYVLFVLFDGPAHLWQLATDNEQAMRA
ISYHTPISRWIVMTLLSGFAIILLPRQFHVTVVENRTPEELRMAGFLLPLYLIAINIFVL
PIALAGILTLGANGDADLYVLQLPLNHQMPVVSLITFIGGFSAATAMVIVASVALSIMIS
NDIVMPIFLRQKLLNRSPHRDDFAKTLLNIRRTAIFAVMLLGYGYYRAADSATGLASIGL
LAFAAIAQMAPALFGGLFWRRANARGAIAGLSSGFFVWAYLLFLPSFGGPDNSEVAANIL
GFLFSGSTVFNGPEADPFVNAVILSLLVNSLAFVLGSLSRNPRPVERIQSGIFVKRHSKS
QFATRGWKTRVSVGDLKSAIARYLGEERMLRSLATYEKTAGRKLNDDQPADMALIHFSEQ
LLGSAIGSSSARLVLSIILQKAEDTSADTAWLLDQASEALQYNQDMLQTALAQMDQGIAV
FDSSQQLTIWNRRFRTLLDLPEQFGQVGVPLTEIVTMLQERGDMPPGDTDELITSFLTMD
LPFSLVLAGGERIIEVRSNTMPDKGIVATFTDITQRVASDQALKQANETLEQRVEERTVE
LTRVNRALAEARASADEANIGKTRFFAAAGHDILQPLNAARLYSSSLVERLGASGESDLV
HNIDSALESVETILGAVLDISRLDTGSMKARMTSVPLNELLKRIETDFAPMAQEKNLDLV
VMPTSLTVRSDPNLLRRLIQNLVSNAIKYTLEGKVVVGARRRGGEVVIQVTDSGIGIPAS
KFRTVFKEFARLDEGAKTASGLGLGLSIVDRLSRMLHHPVQLISTPGKGTTFRIHLPREA
DRLAPAKTEGGTTSPAASDRLHGIRVLCIDNEPKILEGMTLLLTGWGCDVLPAGSVAALE
EPFLTLAAAPDVIIADYHLDDGDGISAIRLIRTFYGKTIPALLVTADRSPEVRSDAEKYG
ISVQHKPVKPAALRAYINQISGTARAAAE