Protein Info for Atu0519 in Agrobacterium fabrum C58

Annotation: protein-glutamate methylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF00072: Response_reg" amino acids 7 to 110 (104 residues), 81.1 bits, see alignment E=6.7e-27 PF01339: CheB_methylest" amino acids 161 to 339 (179 residues), 212.6 bits, see alignment E=3.5e-67

Best Hits

Swiss-Prot: 100% identical to CHEB1_AGRFC: Protein-glutamate methylesterase/protein-glutamine glutaminase (cheB) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03412, two-component system, chemotaxis family, response regulator CheB [EC: 3.1.1.61] (inferred from 100% identity to atu:Atu0519)

Predicted SEED Role

"Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)" in subsystem Bacterial Chemotaxis (EC 3.1.1.61)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See O85128 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Atu0519 protein-glutamate methylesterase (Agrobacterium fabrum C58)
MSALARVLVVDDSPTMRGLISAVLKADPEVEVVGQAGNAMEARAAIKQLNPDVVTLDIEM
PEMNGLEFLEKIMRLRPMPVIMVSSLTHRGADASLAALEIGAFDCVGKPAPGDARPFGDL
ADKVKAAARSQHAAYRATRPETAAAPQPVPMSEYRAGRKVVAIGSSTGGVEALIAVLQKF
PANCPPTVITQHMPPTFTKSFAERLNRICAPVVEEATDGARLQTGKIYLAPGGERHLQIA
NRSAPCCRLLDRDPVNGHRPSVDVLFDSVAELAGRNAVGVILTGMGRDGAAGLLKMRHAG
ARTVGQNEKTCVVYGMPRVAYELGAVEQQLPLASIGEEILKLTTARKEGAD