Protein Info for Atu0494 in Agrobacterium fabrum C58

Annotation: large atp-dependant helicase-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 792 PF00270: DEAD" amino acids 1 to 161 (161 residues), 88.9 bits, see alignment E=7.9e-29 PF04851: ResIII" amino acids 2 to 159 (158 residues), 24.3 bits, see alignment E=6.7e-09 TIGR04121: DEXH box helicase, DNA ligase-associated" amino acids 2 to 786 (785 residues), 1078.4 bits, see alignment E=0 PF00271: Helicase_C" amino acids 215 to 316 (102 residues), 61.1 bits, see alignment E=2.9e-20 PF19306: WH_Lhr" amino acids 357 to 516 (160 residues), 137.4 bits, see alignment E=7.8e-44 PF08494: DEAD_assoc" amino acids 569 to 758 (190 residues), 190.4 bits, see alignment E=7.8e-60

Best Hits

KEGG orthology group: K03724, ATP-dependent helicase Lhr and Lhr-like helicase [EC: 3.6.4.-] (inferred from 100% identity to atu:Atu0494)

Predicted SEED Role

"FIG003033: Helicase domain protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D1C7 at UniProt or InterPro

Protein Sequence (792 amino acids)

>Atu0494 large atp-dependant helicase-related protein (Agrobacterium fabrum C58)
MLLIAPTGAGKTLGGFMASLTDLAERGKVPPGSGFVGVHTLYISPLKALAVDIERNLTRP
VSEMGLPIVIETRTGDTPQAKRQRQKVKPPDILLTTPEQVSLLLANKEAERFFRDLKYVV
LDELHSLVTSKRGHLLSLALARVRRHAPDVRFIGLSATVAEPMDLRRYLAPQGQGEPPAG
LITVEGGAKPDISILHTEERIPWSGHSARYAGKDLYEALKQHQTTLVFVNTRSQAERVFQ
ELWTVNDDNLPIALHHGSLDAGQRRRVEAAMAENKLRAVVATSTLDLGIDWGDVDLVVHV
GAPKGASRLAQRIGRSNHRMDEPSKAILVPANRFEVMECRAALDANYIGAQDTPPIAEGA
LDVLAQHVLGMACAEPFDADELYREVTSASPYANLPRATFDRVVDFTATGGYALRTYERY
ARIRQMKDGRWRVSNPAVAQQYRLNLGTIVEAAELNVRMVKRNAKGTVGRGGMSLGKVEE
YFLEQLVQGDTFLFAGKVLRFEGIRENECLVSQAFSMDPKIPSYAGGKFPLSTYLADQVR
SMLADPARWQALPDQVRDWLEIQKEKSIIPKRDELLVETFPFRKRFFMVMYPFEGRLAHQ
TLGMLLTRRLERAGAKPMGFVATDYSLAIWAMEDIGMRLKSRRLSLADLLDEDMLGDDLE
AWLDESFMLKRTFRNCAVISGLIERRHPGKEKTGRQVTVSADLIYDVLRSHEPDHILLEA
TRRDAAAGLLDIGRLGDMLKRIKGHTTHRALEHVSPLAVPVMLEIGRETVAGEAMDDVLA
EAADELIAEAMS