Protein Info for Atu0474 in Agrobacterium fabrum C58

Annotation: putative RNA polymerase sigma-70 factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 22 to 180 (159 residues), 79.1 bits, see alignment E=1.5e-26 PF04542: Sigma70_r2" amino acids 27 to 94 (68 residues), 59.7 bits, see alignment E=2.9e-20 PF08281: Sigma70_r4_2" amino acids 125 to 176 (52 residues), 42.3 bits, see alignment E=7e-15 PF04545: Sigma70_r4" amino acids 129 to 178 (50 residues), 33.7 bits, see alignment E=3.2e-12

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to atu:Atu0474)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D1E6 at UniProt or InterPro

Protein Sequence (181 amino acids)

>Atu0474 putative RNA polymerase sigma-70 factor (Agrobacterium fabrum C58)
MGSAPDDLDRALAACARGDRNALRVIFEREAGRLIAVAERIVKRRELAEEVVQESFVRIW
THAPQYRADHGSARGWIYAIVRNRALNLLRDGSRELTVQDVETLRDSEQADEVVAAWQKL
DRNSRLYECLGALDETKRQGILMAYVAGYSHGEIAGRLRVPLGTTKSWIRRGLSALRECM
A