Protein Info for Atu0434 in Agrobacterium fabrum C58

Annotation: 2'-deoxycytidine 5'-triphosphate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF06559: DCD_N" amino acids 10 to 171 (162 residues), 262 bits, see alignment E=3.1e-82 PF22769: DCD" amino acids 12 to 169 (158 residues), 140.1 bits, see alignment E=9.6e-45 amino acids 175 to 340 (166 residues), 104.4 bits, see alignment E=9.8e-34 PF22569: DCD_C" amino acids 177 to 367 (191 residues), 306 bits, see alignment E=1.2e-95

Best Hits

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 100% identity to atu:Atu0434)

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKA1 at UniProt or InterPro

Protein Sequence (370 amino acids)

>Atu0434 2'-deoxycytidine 5'-triphosphate deaminase (Agrobacterium fabrum C58)
MTRTTGTRTTGILADGAIRALFAGDKLKSEADLDVDQVQPASLDLRLGSKAYRVRASFMP
GPGTRVIDKLNRFSLHEVDLSQGAVLETGCVYIVPLMESLALPADMSASANPKSSTGRLD
IFTRVMTDNAQEFDKIPAGYTGPLYLEISPRTFPIVVRRGSRLSQIRFRIGHALLNESEV
LKLHETETLVASENPNVTGGGIALSIDLKGFGENGLIGYRGKHHTAVVDVDKKAQHDVLD
FWEPLFARGRAELILDPDEFYILVSREAVHVPPLYAAEMTPFDPLVGEFRVHYAGFFDPG
FGHAQAGGTGSRAVLEVRSHEVPFILEHGQIVGRLVYEHMLEKPEGLYGTGLGSNYQAQG
LKLSKHFRAE