Protein Info for Atu0421 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 44 to 68 (25 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 191 to 215 (25 residues), see Phobius details amino acids 257 to 282 (26 residues), see Phobius details amino acids 298 to 321 (24 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 396 to 427 (32 residues), see Phobius details amino acids 462 to 485 (24 residues), see Phobius details PF12501: DUF3708" amino acids 7 to 172 (166 residues), 185.2 bits, see alignment E=7.4e-59 TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 189 to 489 (301 residues), 287.6 bits, see alignment E=4.6e-90 PF00528: BPD_transp_1" amino acids 273 to 490 (218 residues), 50.4 bits, see alignment E=2.3e-17

Best Hits

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 100% identity to atu:Atu0421)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKA6 at UniProt or InterPro

Protein Sequence (494 amino acids)

>Atu0421 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MNTSILLLILALIGIGSYLLGRRRAVVLSGGRPSSMHSRAGYHGSYAVVWAVLPAAFILC
AWLVISPLLVTSAVRGDFPEDVRAQSEAQQSLTYGMVTSIARGLQRLAPEETAQVEADTA
AVRPLLASKGVAIAGEPQRFMVDAAQTLNAMTSTSRLGMIATVLLVAFAGAAYALRSIAP
RFRARNRVERVILAALVVASSIAILTTIGIVLSMLTEAIQFFTMVPAHQFFFGTVWDPRF
AAAGATDSSGQFGLIPLLAGTLYIGFVAMLVAVPVGLFSAIYMSEYATPRLRSVVKPLLE
VLAGIPTIVYGFFALTTVGPFLRDISTQINGLATGNYANFIQAQSVITAGFVMGIMLIPY
VSSLSDDIITAVPRSLRDGSLGLGATRSETIKKVIVPAALPGIVGAVLMTASRAIGETMI
VVLAAGVAARLQLNPFEPMTTVTVKIVSQLTGDLEFTSPQTLVAFALGITLFAITLCLNI
YALYIVRKYREQYE