Protein Info for Atu0408 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details amino acids 302 to 325 (24 residues), see Phobius details amino acids 345 to 368 (24 residues), see Phobius details amino acids 383 to 405 (23 residues), see Phobius details amino acids 417 to 437 (21 residues), see Phobius details amino acids 485 to 505 (21 residues), see Phobius details amino acids 533 to 553 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 82 to 280 (199 residues), 51.6 bits, see alignment E=4.9e-18 amino acids 360 to 553 (194 residues), 32.5 bits, see alignment E=3.5e-12

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 100% identity to atu:Atu0408)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKB0 at UniProt or InterPro

Protein Sequence (558 amino acids)

>Atu0408 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MNPDTIQPLPPRTRARFSSTFWWLGLSLLAVCGAMVPVLALVSQAVQGSEGLWDHLGATV
LWTALPDTAILLAGVGLLAGVVGTSAAWLVTAYDFPGRRVLEWALLLPLAMPTYIVAYAY
LDILHPIGPVQGAIRWLLGYSSPREFRLPDIRSTVGCIVLLGFVLFPYVYIPVRAMFLTQ
AGNLLEVARTLGVSRRAAFFKVAVPLARPAIAVGVSLALMEALNDIGASEFLGVRTLTVS
VYTTWVTKSDLPGAAQIALSMLFIVVALVALERWARRKQRYSVSAQKSRELEPLRLTGPR
GWAAFTLGSLPVLIGFVGPASYLVIEAWKRFRFSGLSVRFADEAVNTIVFAGLATLITLI
LGLAVAYAMRLAPGRLSLWSYRLSTVGYAAPGTVIAIGVLIALGGFDRFVDQTMRDWFGI
STGLIFIGSGAALIYAYSARFLTIAAGGVDAGLSRIPHSFDHASRTLGRSATQTFRQIHL
PLSKASLAAAALLIFVDCVKELPATLLLRPLNFETFATHLYGEAARGTYEEASIAALAIV
VIGMLPVVLLARIGRRKG