Protein Info for Atu0396 in Agrobacterium fabrum C58

Annotation: coenzyme A transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 PF02550: AcetylCoA_hydro" amino acids 11 to 215 (205 residues), 101.9 bits, see alignment E=7.6e-33 TIGR03458: succinate CoA transferase" amino acids 13 to 494 (482 residues), 752.7 bits, see alignment E=8.3e-231 PF13336: AcetylCoA_hyd_C" amino acids 328 to 463 (136 residues), 140.9 bits, see alignment E=5.1e-45

Best Hits

Swiss-Prot: 50% identical to CAT1_CLOK5: Succinyl-CoA:coenzyme A transferase (cat1) from Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)

KEGG orthology group: K01067, acetyl-CoA hydrolase [EC: 3.1.2.1] (inferred from 100% identity to atu:Atu0396)

MetaCyc: 50% identical to succinyl-CoA:CoA transferase (Clostridium kluyveri)
RXN-8807 [EC: 2.8.3.18]

Predicted SEED Role

"Acetyl-CoA hydrolase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.18 or 3.1.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D1J4 at UniProt or InterPro

Protein Sequence (498 amino acids)

>Atu0396 coenzyme A transferase (Agrobacterium fabrum C58)
MLEKRIRNASLLNRIVSAEEAASLIQDGMTVGMSGFTRAGEAKAVPLALAERAKTNPMKI
TLMTGASLGNDLDKTMVEAGMLARRMPFQSDPALRKAINDGRVMFIDQHLSETVEQLRGG
QIHGVDIAIVEAVAITAEGGIVPTTSVGNSASFAILADKVIVEINLSQPEVLEGLHDIFI
PAKRPTRMPIPVVATDSRVGLPFIPVPPEKIAAIVLSDKSDSFSTVLPPDDETKAIAGHL
TEFLLNEVRHGRMTHELQPLQAGIGTIANAVMHGFIDTPFHDLKMYSEVLQDSTFELFDA
GKLTFASGSSITLSSAMNEQVMPRLSEYKSRLILRPQEVSNHPEVIRRLGIIGINTALEF
DIYGNVNSTHVGGTHMMNGIGGSGDFARNAYMSIFVTKSIAKGGAISSVVPMVSHVDHTE
HDVDILVTETGLADLRGLAPRERAAVIIANCVHPSYRDALTDYYQRAAARGGHTPHLIEE
ALSWHNALRERGTMLPQR