Protein Info for Atu0393 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 69 to 93 (25 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 179 to 202 (24 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 88 to 265 (178 residues), 69 bits, see alignment E=2.3e-23

Best Hits

Swiss-Prot: 32% identical to YESQ_BACSU: Probable ABC transporter permease protein YesQ (yesQ) from Bacillus subtilis (strain 168)

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu0393)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKB7 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Atu0393 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MAVFRKYFPHLVLALGAFVMLLPFYWMALTSIRSPAEIFDVSLWPIPQKFDAADNYARAA
GQVPMARFMLNGVIVCVGILVVQILTSVPAAYALAKLRFPGRKLLLGLVIAALCVPIQAL
ALPLFVGLAKTQLLNTYFAMMMPFFLSVFAIFLFNQSFRSYPDEIIEAARMDGFSEMEIC
WGLVLRGSLPSLAAFSIFSLVAHWNDLYWPMIVISDTNLAPPPLGMMLFADVESGANYGA
LMAGATLITAPMVLCFLLARRHFIAGITMTGVK