Protein Info for Atu0367 in Agrobacterium fabrum C58

Annotation: methionyl-tRNA formyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 TIGR00460: methionyl-tRNA formyltransferase" amino acids 3 to 303 (301 residues), 250.3 bits, see alignment E=1.2e-78 PF00551: Formyl_trans_N" amino acids 4 to 181 (178 residues), 126.6 bits, see alignment E=9.4e-41 PF02911: Formyl_trans_C" amino acids 206 to 302 (97 residues), 75.9 bits, see alignment E=2.5e-25

Best Hits

Swiss-Prot: 100% identical to FMT_AGRFC: Methionyl-tRNA formyltransferase (fmt) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00604, methionyl-tRNA formyltransferase [EC: 2.1.2.9] (inferred from 100% identity to atu:Atu0367)

Predicted SEED Role

"Methionyl-tRNA formyltransferase (EC 2.1.2.9)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or Folate Biosynthesis (EC 2.1.2.9)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UID0 at UniProt or InterPro

Protein Sequence (311 amino acids)

>Atu0367 methionyl-tRNA formyl transferase (Agrobacterium fabrum C58)
MSLRIIFMGTPDFSVPTLRALVEAGHEIVAVYTQPPRPGGRRGLDLQKSPVHQVAELLGL
PVLTPVNFKAEEDRQQFRDFNADVAVVVAYGLLLPEAILSGTRLGCYNGHASLLPRWRGA
APIQRAIMAGDAETGMMVMKMEKGLDTGPVALTAKVAIDENMTAGELHDSLMLAGARLMR
QAMAKLEADDLPLVTQAEEGVLYAAKIDKGETRIDFSRPAQDVHNHIRGLSPFPGAWLEM
DIGGKPERVKVLASELASGMGEAGSALDDALTIACGSDAVRLTRLQKAGGKPMSAADFVR
GTPVPATTRLG