Protein Info for Atu0366 in Agrobacterium fabrum C58

Annotation: polypeptide deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 PF01327: Pep_deformylase" amino acids 4 to 155 (152 residues), 186.7 bits, see alignment E=1.1e-59 TIGR00079: peptide deformylase" amino acids 6 to 161 (156 residues), 181.7 bits, see alignment E=3.8e-58

Best Hits

Swiss-Prot: 100% identical to DEF_AGRFC: Peptide deformylase (def) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01462, peptide deformylase [EC: 3.5.1.88] (inferred from 100% identity to atu:Atu0366)

MetaCyc: 46% identical to peptide deformylase (Escherichia coli K-12 substr. MG1655)
Peptide deformylase. [EC: 3.5.1.88]

Predicted SEED Role

"Peptide deformylase (EC 3.5.1.88)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase (EC 3.5.1.88)

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.88

Use Curated BLAST to search for 3.5.1.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UID1 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Atu0366 polypeptide deformylase (Agrobacterium fabrum C58)
MTIKPLIILPDPVLRQQSKLIEQVDAEVLRLADDMLETMYDAPGIGLAAIQIGVPRRMLV
IDVAREGEEKTPVVFINPEILKVSDDISTYEEGCLSIPDYYAEVERPASLTVQYVGRDGK
QQTVEADGLLATCLQHEIDHLNGVLFIDHISRLKRDMVIKKFTKAARAKI