Protein Info for Atu0365 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details PF02646: RmuC" amino acids 100 to 380 (281 residues), 202.4 bits, see alignment E=4.4e-64

Best Hits

KEGG orthology group: K09760, DNA recombination protein RmuC (inferred from 100% identity to atu:Atu0365)

Predicted SEED Role

"DNA recombination protein RmuC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKC6 at UniProt or InterPro

Protein Sequence (410 amino acids)

>Atu0365 hypothetical protein (Agrobacterium fabrum C58)
MIFRITGNLLDLIMNIDFSVLLNPALRAGSVDISFGALLVALVLGLTITWLVTTNRTRKA
GADSEISDLLKTQSELHGRIAAMAETLGTRQTEMSQTLNQRLDGMSQRLGETLTEQTRST
HENLSRLQERLAVIDAAQGNIQDLAKDVVGLQAILSNKQTRGAFGQARMETLIADALPAG
AFQLQPTLSNGYRPDCIIKMPNNAPALVIDAKFPLEAWNAIKADETPETKRAAVQQFRRD
MEVHIRDVAEKYLIRGETQDTAFIFVPSESIFADIHQHFEYLVQRAHRARVVIVSPSLLM
LSVQVIQSVLKDQRMREQAHLIQGEVALLMDDVRRLDDRTRKLQAHFGLAQKDVDMMLIS
SDKVLARGQKIEGLDFSPTEKEASHGEIEQTRRFAENRAGAAKLRVVDDE