Protein Info for Atu0362 in Agrobacterium fabrum C58

Annotation: S-adenosylmethionine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00438: S-AdoMet_synt_N
  • amino acids 4 to 129 (126 residues), 92.5 bits, E=3.1e-30
• TIGR01034: methionine adenosyltransferase
  • amino acids 96 to 417 (322 residues), 390.2 bits, E=4.7e-121
• PF02772: S-AdoMet_synt_M
  • amino acids 145 to 263 (119 residues), 124.4 bits, E=4.4e-40
• PF02773: S-AdoMet_synt_C
  • amino acids 265 to 407 (143 residues), 218.3 bits, E=5.1e-69

Best Hits

Swiss-Prot: 69% identical to METK_METS4: S-adenosylmethionine synthase (metK) from Methylobacterium sp. (strain 4-46)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 100% identity to atu:Atu0362)

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• S-adenosyl-L-methionine salvage II (3/3 steps found)
• S-adenosyl-L-methionine biosynthesis (1/1 steps found)
• S-adenosyl-L-methionine salvage I (3/4 steps found)
• L-methionine degradation I (to L-homocysteine) (2/3 steps found)
• ethene biosynthesis I (plants) (1/3 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (2/5 steps found)
• 2'-deoxymugineic acid phytosiderophore biosynthesis (1/4 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (3/7 steps found)
• superpathway of L-methionine salvage and degradation (8/16 steps found)
• L-methionine salvage cycle II (plants) (2/11 steps found)
• L-methionine salvage cycle I (bacteria and plants) (2/12 steps found)
• L-methionine salvage cycle III (1/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.6

Sequence Analysis Tools

See A9CKC8 at UniProt or InterPro

Protein Sequence (420 amino acids)

>Atu0362 S-adenosylmethionine synthetase (Agrobacterium fabrum C58)
MRANYLFTSESVAEGHPDKVCDRISDEIVDLIYREAAKTGVDPWTVRIACETLATTNRVV
IAGEVRVPDTLLKKDKDGKVVKDAAGHPVINPSKFKSAARKAIRDIGYEQDGFHWKTAKI
DVLLHPQSADIAQGVDNASDKQGDEGAGDQGIMFGYACKETPDLMPAPIYYSHRILQLLA
TARKSGEGEAAKLGPDAKSQVTVRYVDGKASEAVSIVLSTQHLDASWDSKKVREVVEPYI
REALGELKIADDCQWYINPTGKFVIGGPDGDAGLTGRKIIVDTYGGAAPHGGGAFSGKDT
TKVDRSAAYAARYLAKNVVAAGLAERCTIQIAYAIGVAQPLSIYVDLHGTGKVSEDQVEA
AIRKVMDLSPSGIRRHLDLNKPIYAKTSSYGHFGRKAGRDGSFSWEKLDLVKPLKEALSA